Dusp3 (NM_028207) Mouse Recombinant Protein
CAT#: TP501720
Purified recombinant protein of Mouse dual specificity phosphatase 3 (vaccinia virus phosphatase VH1-related) (Dusp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201720 representing NM_028207
Red=Cloning site Green=Tags(s) MSSSFELSVQDLNDLLSDGSGCYSLPSQPCNEVVPRVYVGNASVAQDITQLQKLGITHVLNAAEGRSFMH VNTSASFYEDSGITYLGIKANDTQEFNLSAYFERATDFIDQALAHKNGRVLVHCREGYSRSPTLVIAYLM MRQKMDVKSALSTVRQNREIGPNDGFLAQLCQLNDRLAKEGKVKL SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-MYC/DDK |
Predicted MW | 20.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_082483 |
Locus ID | 72349 |
UniProt ID | Q9D7X3 |
Refseq Size | 4204 |
Cytogenetics | 11 D |
Refseq ORF | 555 |
Synonyms | 2210015O03Rik; 5031436O03Rik; T-DSP11; VHR |
Summary | Shows activity both for tyrosine-protein phosphate and serine-protein phosphate, but displays a strong preference toward phosphotyrosines. Specifically dephosphorylates and inactivates ERK1 and ERK2 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |