Rcan1 (NM_019466) Mouse Recombinant Protein
CAT#: TP501965
Purified recombinant protein of Mouse regulator of calcineurin 1 (Rcan1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR201965 protein sequence
Red=Cloning site Green=Tags(s) MHFRDFSYNFSSLIACVANDDVFSESETRAKFESLFRTYDKDTTFQYFKSFKRVRINFSNPLSAADARLR LHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGP GEKYELHAATDTTPSVVVHVCESDQENEEEEEEMERMKRPKPKIIQTRRPEYTPIHLS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 22.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062339 |
Locus ID | 54720 |
UniProt ID | Q9JHG6 |
Refseq Size | 2195 |
Cytogenetics | 16 53.6 cM |
Refseq ORF | 597 |
Synonyms | Adapt78; CALP1L; CSP1; DSC1; Dscr1; MCIP1; RCN1 |
Summary | Inhibits calcineurin-dependent transcriptional responses by binding to the catalytic domain of calcineurin A. Could play a role during central nervous system development (PubMed:11231093).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |