Mad2l1 (NM_019499) Mouse Recombinant Protein

CAT#: TP502160

Purified recombinant protein of Mouse MAD2 mitotic arrest deficient-like 1 (Mad2l1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202160 representing NM_019499
Red=Cloning site Green=Tags(s)

MAQQLAREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLTTTDPELIKYLNNVVE
QLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKEEGVRREKSQKAIQDEIRSVIRQITATVT
FLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNCEEVRLRSFTTTIHKVNSMVAYKTPVND

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 24 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062372
Locus ID 56150
UniProt ID Q9Z1B5, Q5HZH8
Refseq Size 1725
Cytogenetics 6 30.56 cM
Refseq ORF 615
Synonyms AA673185; MAD2
Summary Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...