Snap25 (NM_011428) Mouse Recombinant Protein
CAT#: TP502184
Purified recombinant protein of Mouse synaptosomal-associated protein 25 (Snap25), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202184 protein sequence
Red=Cloning site Green=Tags(s) MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKD MKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 23.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035558 |
Locus ID | 20614 |
UniProt ID | P60879 |
Refseq Size | 2135 |
Cytogenetics | 2 67.56 cM |
Refseq ORF | 621 |
Synonyms | Bdr; GENA70; SNAP-25; sp; SUP |
Summary | t-SNARE involved in the molecular regulation of neurotransmitter release (PubMed:8243676, PubMed:8103915). May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF (PubMed:16672379). Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 in pancreatic beta cells (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |