Rab17 (NM_008998) Mouse Recombinant Protein
CAT#: TP502342
Purified recombinant protein of Mouse RAB17, member RAS oncogene family (Rab17), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202342 protein sequence
Red=Cloning site Green=Tags(s) MAQAAGLPQASTASGQPYLSKLVLLGSSSVGKTSLALRYMKQDFSNVLPTVGCAFFTKVLDLGSSSLKLE IWDTAGQEKYQSVCHLYFRGANAALLVYDITRKDSFHKAQQWLEDLEKEFQPGEVVVMLVGNKTDLGEER EVTFQEGKEFAESKSLLFMETSAKLNYQVSEIFNTVAQELLQRAGDTGSSRPQEGEAVALNQEPPIRQRQ CCAR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 23.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033024 |
Locus ID | 19329 |
UniProt ID | P35292 |
Refseq Size | 1825 |
Cytogenetics | 1 45.84 cM |
Refseq ORF | 645 |
Synonyms | AW413472 |
Summary | The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in transcytosis, the directed movement of endocytosed material through the cell and its exocytosis from the plasma membrane at the opposite side. Mainly observed in epithelial cells, transcytosis mediates for instance, the transcellular transport of immunoglobulins from the basolateral surface to the apical surface. Most probably controls membrane trafficking through apical recycling endosomes in a post-endocytic step of transcytosis. Required for melanosome transport and release from melanocytes, it also regulates dendrite and dendritic spine development. May also play a role in cell migration.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |