Nola1 (BC021873) Mouse Recombinant Protein

CAT#: TP502402

Purified recombinant protein of Mouse nucleolar protein family A, member 1 (H/ACA small nucleolar RNPs) (cDNA clone MGC:28064 IMAGE:3709271),, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202402 protein sequence
Red=Cloning site Green=Tags(s)

MSFRGGGRGGFNRGGGGGGFNRGGGGGSFRGGGGGGSFRGGGRGGFGRGGGRGGFNKFQDQGPPERVVLL
GEFMHPCEDDIVCKCTTEENKVPYFNAPVYLENKEQVGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQK
FYIDPYKLLPLQRFLPRPPGEKGPPRGGGGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGFRGGRGGG
GFRGRGH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 22.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 68147
UniProt ID Q9CY66
Refseq Size 1145
Cytogenetics 3 G3
Refseq ORF 651
Synonyms GAR1
Summary Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is subsequently attached to C5, instead of the normal N1. Each rRNA can contain up to 100 pseudouridine ("psi") residues, which may serve to stabilize the conformation of rRNAs. May also be required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transcriptase (TERT) holoenzyme (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...