Mettl21a (NM_025964) Mouse Recombinant Protein

CAT#: TP502463

Purified recombinant protein of Mouse methyltransferase like 21A (Mettl21a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202463 protein sequence
Red=Cloning site Green=Tags(s)

MALVPYEESAAIGLQKFHKPLATFSFANHTIQIRQDWRQLGVAAVVWDAAVVLSMYLEMGAVELRGCSAV
ELGAGTGLVGIVAALPGAQVTITDRKVALEFLKSNVEANLPPHIQPKAVVKELTWGQNLESFSPGEFDLI
LGADVIYLEDTFTDLLQTLGHLCSNNSVILLACRIRYERDSNFLTMLERQFTVSKVHYDPEKDVHIYKAQ
KRNQREDL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 24.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080240
Locus ID 67099
UniProt ID Q9CQL0
Refseq Size 2666
Cytogenetics 1 C2
Refseq ORF 657
Synonyms 2310038H17Rik; AI464204; Fam119a
Summary Protein-lysine methyltransferase that selectively trimethylates residues in heat shock protein 70 (HSP70) family members. Contributes to the in vivo trimethylation of Lys residues in HSPA1 and HSPA8. In vitro methylates 'Lys-561' in HSPA1, 'Lys-564' in HSPA2, 'Lys-585' in HSPA5, 'Lys-563' in HSPA6 and 'Lys-561' in HSPA8 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...