Eif3k (NM_028659) Mouse Recombinant Protein
CAT#: TP502466
Purified recombinant protein of Mouse eukaryotic translation initiation factor 3, subunit K (Eif3k), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
货期*
4周
规格
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202466 protein sequence
Red=Cloning site Green=Tags(s) MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQIL LKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRK FICHVVGITYQHIDRWLLAEMLGDLTDNQLKVWMSKYGWSADESGQVFICSQEESIKPKNIVEKIDFDSV SSIMASSQ myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_082935 |
Locus ID | 73830 |
UniProt ID | Q9DBZ5 |
Refseq Size | 866 |
Cytogenetics | 7 B1 |
Refseq ORF | 657 |
Synonyms | 1200009C21Rik; Eif3s12 |
Summary | Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...