Gimap4 (BC005577) Mouse Recombinant Protein
CAT#: TP502489
Purified recombinant protein of Mouse GTPase, IMAP family member 4 (cDNA clone MGC:11734 IMAGE:3968418), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202489 protein sequence
Red=Cloning site Green=Tags(s) MEVQCGGAGFIPESSRSSHELGNQDQGIPQLRIVLLGKTGAGKSSTGNSILGEKVFNSGICAKSITKVCE KRVSTWDGKELVVVDTPGIFDTEVPDADTQREITRYVALTSPGPHALLLVVPLGRYTVEEHKATQKILDM FGKQARRFMILLLTRKDDLEDTDIHEYLEKAPKFFQEVMHEFQNRYCLFNNRASGAEKEEQKMQLLTLVQ SMFLSSRMK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 24.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 107526 |
UniProt ID | Q99JY3 |
Refseq Size | 1364 |
Cytogenetics | 6 B2.3 |
Refseq ORF | 657 |
Synonyms | MGC11734, IMAP4, mIAN1 |
Summary | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. This gene exists within a cluster of other related genes located on mouse chromosome 6. This family member encodes a lymphoid signaling protein that functions to accelerate programmed T-cell death, which appears to correlate with the phosphorylation status of the protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
Documents
FAQs |
SDS |