Syngr2 (NM_009304) Mouse Recombinant Protein
CAT#: TP502601
Purified recombinant protein of Mouse synaptogyrin 2 (Syngr2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202601 representing NM_009304
Red=Cloning site Green=Tags(s) MESGAYGAANAGGSFDLRRFLSQPQVVTRLVSMVLALIVFSCIFGEGYTNIHTSDQLYCVFNQNEDACRY GSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAATKPQDVRV GADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQNYVDPTPDPNTAYASYPSASVENYQQPPFTQ NVETIEGYQPPPVY myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033330 |
Locus ID | 20973 |
UniProt ID | O55101 |
Refseq Size | 1527 |
Cytogenetics | 11 E2 |
Refseq ORF | 672 |
Synonyms | cellugyrin; Clast2 |
Summary | May play a role in regulated exocytosis. In neuronal cells, modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in the formation and/or the maturation of this vesicles. May also play a role in GLUT4 storage and transport to the plasma membrane.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |