Crp (NM_007768) Mouse Recombinant Protein
CAT#: TP502645
Purified recombinant protein of Mouse C-reactive protein, pentraxin-related (Crp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202645 protein sequence
Red=Cloning site Green=Tags(s) MEKLLWCLLIMISFSRTFGHEDMFKKAFVFPKESDTSYVSLEAESKKPLNTFTVCLHFYTALSTVRSFSV FSYATKKNSNDILIFWNKDKQYTFGVGGAEVRFMVSEIPEAPTHICASWESATGIVEFWIDGKPKVRKSL HKGYTVGPDASIILGQEQDSYGGDFDAKQSLVGDIGDVNMWDFVLSPEQINTVYVGGTLSPNVLNWRALN YKAQGDVFIKPQLWS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 25.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_031794 |
Locus ID | 12944 |
UniProt ID | P14847 |
Refseq Size | 1698 |
Cytogenetics | 1 80.13 cM |
Refseq ORF | 678 |
Synonyms | AI255847 |
Summary | Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |