Chchd3 (NM_025336) Mouse Recombinant Protein
CAT#: TP502692
Purified recombinant protein of Mouse coiled-coil-helix-coiled-coil-helix domain containing 3 (Chchd3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202692 protein sequence
Red=Cloning site Green=Tags(s) MGGTASTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSSVYGASVSDEDLKRRVAEEL ALEQAKKESEHQRRLKQARDLERERAAANEQLTRAVLRERISSEEERMKAKHLARQLEEKDRVMRKQDAF YKEQLARLEERSSEFYKVTTEEYQKAAEEVEAKFKRYEYHPVCADLQTKILQCYRQNTQQTLSCSALASQ YMHCVNHAKQSMLEKGG myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079612 |
Locus ID | 66075 |
UniProt ID | Q9CRB9 |
Refseq Size | 1432 |
Cytogenetics | 6 A3.3 |
Refseq ORF | 684 |
Synonyms | 0610041L09Rik; 1700039J09Rik; AW558177 |
Summary | Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Has also been shown to function as a transcription factor which binds to the BAG1 promoter and represses BAG1 transcription. Plays an important role in the maintenance of the MICOS complex stability and the mitochondrial cristae morphology.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |