Cltb (BC070404) Mouse Recombinant Protein

CAT#: TP502747

Purified recombinant protein of Mouse clathrin, light polypeptide (Lcb) (cDNA clone MGC:92950 IMAGE:5699653), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202747 protein sequence
Red=Cloning site Green=Tags(s)

MAEDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDPGFGAPAASQVASAQPGLASGAGSEDMST
TVNGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQELDAASKVTEQEWREKAKKDLEEWN
QRQSEQVEKNKINNRIADKAFYQQPDADTIGYVASEEAFVKESKEETPGTEWEKVAQLCDFNPKSSKQCK
DVSRLRSVLMSLKQTPLSR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 25.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 74325
UniProt ID Q6IRU5
Refseq Size 1009
Cytogenetics 13 B1
Refseq ORF 687
Synonyms 2310046E19Rik
Summary Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...