Cldn2 (NM_016675) Mouse Recombinant Protein

CAT#: TP502768

Purified recombinant protein of Mouse claudin 2 (Cldn2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202768 protein sequence
Red=Cloning site Green=Tags(s)

MASLGVQLVGYILGLLGLLGTSIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTL
LGLPADIQAAQAMMVTSSAMSSLACIISVVGMRCTVFCQDSRAKDRVAVVGGVFFILGGILGFIPVAWNL
HGILRDFYSPLVPDSMKFEIGEALYLGIISALFSLVAGVILCFSCSPQGNRTNYYDGYQAQPLATRSSPR
SAQQPKAKSEFNSYSLTGYV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 24.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_057884
Locus ID 12738
UniProt ID O88552
Refseq Size 3079
Cytogenetics X F1
Refseq ORF 693
Synonyms AL022813
Summary This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The knockout mice lacking this gene display normal appearance, activity, growth and behavior, but are defective in the leaky and cation-selective paracellular permeability properties of renal proximal tubules. The proteins encoded by this gene and another family member Cldn12 are also critical for vitamin D-dependent Ca2+ absorption between enterocytes. [provided by RefSeq, Aug 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...