D2Ertd750e (BC031709) Mouse Recombinant Protein

CAT#: TP502833

Purified recombinant protein of Mouse DNA segment, Chr 2, ERATO Doi 750, expressed (cDNA clone MGC:30961 IMAGE:4021550), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR202833 protein sequence
Red=Cloning site Green=Tags(s)

MASAKTVCDAQPHSMPSCGLPADTQTRATSKLPVKSKEADLLRHLHPGGPEPDVTKVTKSRRENGQVKAA
ETASRRNLRNSYKPFNKQKPEEELKDKNELLEAVNKQLHQKLTETQGELKDLTQKVELLEKFQDNCLALL
ESKGLNPGQETLASKQEPTTDHTDSMLLLETLKDELKVFNETAKKQMEELQALKVKLKLKEEESVQFLEQ
QTLCKDEASDFTIILEEMEQLLEM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 51944
UniProt ID Q9D9Z1
Refseq Size 1218
Cytogenetics 2 E5
Refseq ORF 702
Synonyms 1700025D04Rik; C15orf23; D2Ertd750e; SKAP; Traf4af1
Summary Essential component of the mitotic spindle required for faithful chromosome segregation and progression into anaphase. Promotes the metaphase-to-anaphase transition and is required for chromosome alignment, normal timing of sister chromatid segregation, and maintenance of spindle pole architecture. The astrin (SPAG5)-kinastrin (SKAP) complex promotes stable microtubule-kinetochore attachments. Required for kinetochore oscillations and dynamics of microtubule plus-ends during live cell mitosis, possibly by forming a link between spindle microtubule plus-ends and mitotic chromosomes to achieve faithful cell division.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...