Alkbh2 (NM_175016) Mouse Recombinant Protein
CAT#: TP502934
Purified recombinant protein of Mouse alkB homolog 2, alpha-ketoglutarate-dependent dioxygenase (Alkbh2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202934 protein sequence
Red=Cloning site Green=Tags(s) MDKFLVRPDLRDLQGGGEEPAPTGGASGDLKSPDWRHLRAEGLSCDYTVLFGKAEADKIFRELEQEVEYF TGALAKVQVFGKWHSVPRKQATYGDAGLTYTFSGLTLTPKPWVPVLERVRDRVCEVTGQTFNFVLVNRYK DGCDHIGEHRDDERELAPGSPIASVSFGACRDFIFRHKDSRGKRPRRTVEVVRLQLAHGSLLMMNPPTNT HWYHSLPIRKRVLAPRVNLTFRKILPTKK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_778181 |
Locus ID | 231642 |
UniProt ID | Q6P6J4 |
Refseq Size | 1148 |
Cytogenetics | 5 F |
Refseq ORF | 720 |
Synonyms | 9530023G02; Abh2; AU016977; mABH2 |
Summary | Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Can also repair alkylated DNA containing 1-ethenoadenine. Has strong preference for double-stranded DNA. Has low efficiency with single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |