Mbl2 (NM_010776) Mouse Recombinant Protein

CAT#: TP503052

Purified recombinant protein of Mouse mannose-binding lectin (protein C) 2 (Mbl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
MBL2 Antibody - middlel region
    • 50 ug

CNY 4,628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203052 protein sequence
Red=Cloning site Green=Tags(s)

MSIFTSFLLLCVVTVVYAETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPG
KVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVK
KMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPN
NTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 26 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034906
Locus ID 17195
UniProt ID P41317
Refseq Size 1069
Cytogenetics 19 25.14 cM
Refseq ORF 735
Synonyms L-MBP; MBL; MBL-C; MBP-C
Summary Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...