Eif6 (NM_010579) Mouse Recombinant Protein
CAT#: TP503068
Purified recombinant protein of Mouse eukaryotic translation initiation factor 6 (Eif6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203068 representing NM_010579
Red=Cloning site Green=Tags(s) MAVRASFENNCEVGCFAKLTNAYCLVAIGGSENFYSVFEGELSDAIPVVHASIAGCRIIGRMCVGNRHGL LVPNNTTDQELQHIRNSLPDSVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQ TVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDT TSTELSVVESVFKLNEAKPSTIATSMRDSLIDSLT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 27 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034709 |
Locus ID | 16418 |
UniProt ID | O55135, Q545K4 |
Refseq Size | 1495 |
Cytogenetics | 2 H1 |
Refseq ORF | 735 |
Synonyms | 1110004P11; AA408895; CAB; eIF; eIF-6; imc-41; imc-415; Itgb4; Itgb4bp; p27(BBP); p27B; p27BBP |
Summary | The protein encoded by this gene is a eukaryotic translation initiation factor that regulates both ribosome biogenesis and translation, which are rate-limiting factors for cell growth. The encoded protein binds 60S ribosomes and prevents their association with 40S ribosomes. This gene may play a role in oncogenesis as well. [provided by RefSeq, Aug 2015] |
Documents
FAQs |
SDS |