Gosr1 (NM_016810) Mouse Recombinant Protein
CAT#: TP503190
Purified recombinant protein of Mouse golgi SNAP receptor complex member 1 (Gosr1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203190 protein sequence
Red=Cloning site Green=Tags(s) MAAGTSNYWEDLRKQARQLENELDLKLVSFSKLCTSYSHSGSRDGGRDRYSSDTTPLLNGSSQDRMFETM AIEIEQLLARLTGVNDKMAEYTHSAGVPSLNAALMHTLQRHRDILQDYTHEFHKTKANFTAIRERENLMG SVRKDIESYKSGSGVNNRRTELFLKEHDHLRNSDRLIEETISIAMATKENMTSQRGMLKSIHSKMNTLAN RFPAVNSLIQRINLRKRRDSLILGGVIGICTILLLLYAFH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_058090 |
Locus ID | 53334 |
UniProt ID | O88630 |
Refseq Size | 4265 |
Cytogenetics | 11 B5 |
Refseq ORF | 753 |
Synonyms | AI414660; AI426320; BB145494; GOS-28; GOSRI; GS28 |
Summary | Involved in transport from the ER to the Golgi apparatus as well as in intra-Golgi transport. It belongs to a super-family of proteins called t-SNAREs or soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptor. May play a protective role against hydrogen peroxide induced cytotoxicity under glutathione depleted conditions in neuronal cells by regulating the intracellular ROS levels via inhibition of p38 MAPK (MAPK11, MAPK12, MAPK13 and MAPK14). Participates in docking and fusion stage of ER to cis-Golgi transport. Plays an important physiological role in VLDL-transport vesicle-Golgi fusion and thus in VLDL delivery to the hepatic cis-Golgi (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |