Igfbp4 (NM_010517) Mouse Recombinant Protein

CAT#: TP503247

Purified recombinant protein of Mouse insulin-like growth factor binding protein 4 (Igfbp4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203247 protein sequence
Red=Cloning site Green=Tags(s)

MLPFGLVAALLLAAGPRPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVY
TPRCGSGMRCYPPRGVEKPLRTLMHGQGVCTELSEIEAIQESLQTSDKDESEHPNNSFNPCSAHDHRCLQ
KHMAKIRDRSKMKIVGTPREEPRPVPQGSCQSELHRALERLAASQSRTHEDLFIIPIPNCDRNGNFHPKQ
CHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFQE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034647
Locus ID 16010
UniProt ID P47879
Refseq Size 2069
Cytogenetics 11 D
Refseq ORF 765
Synonyms AI875747; Deb2; IBP-4; IGFBP-4
Summary IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...