Fstl3 (NM_031380) Mouse Recombinant Protein

CAT#: TP503294

Purified recombinant protein of Mouse follistatin-like 3 (Fstl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203294 protein sequence
Red=Cloning site Green=Tags(s)

MRSGALWPLLWGALVWTVGSVGAVMGSEDSVPGGVCWLQQGREATCSLVLKTRVSREECCASGNINTAWS
NFTHPGNKISLLGFLGLVHCLPCKDSCDGVECGPGKACRMLGGRPHCECVPNCEGLPAGFQVCGSDGATY
RDECELRTARCRGHPDLRVMYRGRCQKSCAQVVCPRPQSCLVDQTGSAHCVVCRAAPCPVPSNPGQELCG
NNNVTYISSCHLRQATCFLGRSIGVRHPGICTGGPKVPAEEEENFV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 27.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_113557
Locus ID 83554
UniProt ID Q9EQC7
Refseq Size 1953
Cytogenetics 10 C1
Refseq ORF 771
Synonyms E030038F23Rik; Flrg
Summary The secreted form is a binding and antagonizing protein for members of the TGF-beta family, such us activin, BMP2 and MSTN. Inhibits activin A-, activin B-, BMP2- and MSDT-induced cellular signaling; more effective on activin A than on activin B. Involved in bone formation; inhibits osteoclast differentiation. Involved in hematopoiesis; involved in differentiation of hemopoietic progenitor cells, increases hematopoietic cell adhesion to fibronectin and seems to contribute to the adhesion of hematopoietic precursor cells to the bone marrow stroma. The nuclear form is probably involved in transcriptional regulation via interaction with MLLT10 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...