Eif4e2 (BC049077) Mouse Recombinant Protein

CAT#: TP503331

Purified recombinant protein of Mouse eukaryotic translation initiation factor 4E member 2 (cDNA clone MGC:61339 IMAGE:5708556), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203331 protein sequence
Red=Cloning site Green=Tags(s)

MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPG
RPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLR
KGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNT
IMEYKTHTDSIAPQGTMSSKLCLMVNPLKVTRPHASTFPLGSVHQQI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 26987
UniProt ID Q8BMB3
Refseq Size 2855
Cytogenetics 1 C5
Refseq ORF 771
Synonyms 2700069E09Rik; AI036339; AV129531; D0H0S6743E; Eif4el3
Summary Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation (PubMed:15153109). Acts as a repressor of translation initiation (By similarity). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap (PubMed:15153109).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...