Uck2 (NM_030724) Mouse Recombinant Protein

CAT#: TP503431

Purified recombinant protein of Mouse uridine-cytidine kinase 2 (Uck2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203431 protein sequence
Red=Cloning site Green=Tags(s)

MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYHQKQVVILSQDSFYRVLTS
EQKAKALKGQFNFDHPDAFDNELIFKTLKEITEGKTVQIPVYDFVSHSRKEETVTIYPADVVLFEGILAF
YSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPR
GADNLVAINLIVQHIQDILNGGLSKRQTNGYLNGYTPSRKRQASESSSRPH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_109649
Locus ID 80914
UniProt ID Q99PM9
Refseq Size 1338
Cytogenetics 1 H2.3
Refseq ORF 786
Synonyms AA407809; AI481316; AU018180; AU020720; TSA903; UK; UMK; Umpk
Summary Phosphorylates uridine and cytidine to uridine monophosphate and cytidine monophosphate. Does not phosphorylate deoxyribonucleosides or purine ribonucleosides. Can use ATP or GTP as a phosphate donor. Can also phosphorylate cytidine and uridine nucleoside analogs such as 6-azauridine, 5-fluorouridine, 4-thiouridine, 5-bromouridine, N(4)-acetylcytidine, N(4)-benzoylcytidine, 5-fluorocytidine, 2-thiocytidine, 5-methylcytidine, and N(4)-anisoylcytidine (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...