Erp29 (NM_026129) Mouse Recombinant Protein

CAT#: TP503447

Purified recombinant protein of Mouse endoplasmic reticulum protein 29 (Erp29), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203447 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAGVSGAASLSPLLSVLLGLLLLFAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGE
KQDEFKRLAENSASSEELLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDLENPVLYNGAVKV
GAIQRWLKGQGVYLGMPGCLPAYDALAGEFIKASSIEARQAILKQGQDGLLSVKETEKKWASQYLKIMGK
ILDQGEDFPASEMARIGKLIENKMSDSKKEELQKSLNILTAFRKKEAEKEEL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080405
Locus ID 67397
UniProt ID P57759
Refseq Size 1258
Cytogenetics 5 F
Refseq ORF 789
Synonyms 1200015M03Rik; 2810446M09Rik; AW209030; Erp28; Erp31; PDI-Db
Summary Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...