Mettl1 (NM_010792) Mouse Recombinant Protein
CAT#: TP503548
Purified recombinant protein of Mouse methyltransferase like 1 (Mettl1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203548 protein sequence
Red=Cloning site Green=Tags(s) MMAGAEAPQPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLNQNKNHDDPKDEKEKHSGA QVEFADIGCGYGGLLVALSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPGGGFQNIACLRSNAMKHLP NFFRKGQLAKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTVTDVPELHEWMCTHFEEHPL FECVPLEELSEDPIVEHLGSSTEEGKKVLRNGGKNFPAVFRRIQDPLLQAVTPNPTLP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 30.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034922 |
Locus ID | 17299 |
UniProt ID | Q9Z120 |
Refseq Size | 887 |
Cytogenetics | 10 D3 |
Refseq ORF | 807 |
Synonyms | 2810012D02Rik |
Summary | Methyltransferase that mediates the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed:29983320). Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. Also acts as a methyltransferase for a subset of internal N(7)-methylguanine in mRNAs (PubMed:29983320). Internal N(7)-methylguanine methylation of mRNAs regulates translation (PubMed:29983320). Also methylates a specific subset of miRNAs, such as let-7. N(7)-methylguanine methylation of let-7 miRNA promotes let-7 miRNA processing by disrupting an inhibitory secondary structure within the primary miRNA transcript (pri-miRNA) (By similarity). Acts as a regulator of embryonic stem cell self-renewal and differentiation (PubMed:29983320).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |