Mad2l1bp (NM_025649) Mouse Recombinant Protein

CAT#: TP503719

Purified recombinant protein of Mouse MAD2L1 binding protein (Mad2l1bp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203719 protein sequence
Red=Cloning site Green=Tags(s)

MAASGEEDMSELSPAAAPNLDWYEKPEETHAPEVDLETVIPPAQEPSNPAEPFCPRDLVPVVFPGPVSQE
DCCQFTCELLKHILYQRHQLPLPYEQLKHFYRKAPQAEDTARKKAWLATEARNRKCQQALAELESVLSHL
RDFFARTLVPQVLILLGGNALSPKEFYELDLSRLAPFGVDQGLNTAACLRRLFRAIFLADPFSELQTPPL
MGTIVMVQGHRDCGEDWFQPKLNYRVPSRGHKLTVTLSCGRPSVPAMASEDYIWFQAPVTLKGFHE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 31.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079925
Locus ID 66591
UniProt ID Q9DCX1
Refseq Size 1288
Cytogenetics 17 C
Refseq ORF 831
Synonyms 0610009D16Rik; 2510031P20Rik; AU018945; AW550977; C76045; CMT2A; CMT2B; Mad2lbp; mKIAA0110
Summary May function to silence the spindle checkpoint and allow mitosis to proceed through anaphase by binding MAD2L1 after it has become dissociated from the MAD2L1-CDC20 complex.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...