Xpa (BC029241) Mouse Recombinant Protein

CAT#: TP503762

Purified recombinant protein of Mouse xeroderma pigmentosum, complementation group A (cDNA clone MGC:36016 IMAGE:4489063), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203762 representing BC029241
Red=Cloning site Green=Tags(s)

MATAEEKQTSPEPVAADEPAQLPAAVRASVERKRQRALMLRQARLAARPYPAAAATGGVASVKAAPKMID
TKGGFILEEEEEKHEIGNIVHEPGPVMEFDYTICEECGKEFMDSYLMNHFDLPTCDSCRDADDKHKLITK
TEAKQEYLLKDCDLEKREPALRFLVKKNPRHSQWGDMKLYLKLQVVKRALEVWGSQEALEDAKEVRQENR
EKMKQKKFDKKVKVGLDDAVKILLDDKPLHRMAPWHNRALEKRSSVLTRTTTKQISFIYSINTCDCCAK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 22590
UniProt ID Q64267
Refseq Size 1234
Cytogenetics 4 24.49 cM
Refseq ORF 837
Synonyms AI573865; Xpac
Summary Involved in DNA excision repair. Initiates repair by binding to damaged sites with various affinities, depending on the photoproduct and the transcriptional state of the region. Required for UV-induced CHEK1 phosphorylation and the recruitment of CEP164 to cyclobutane pyrimidine dimmers (CPD), sites of DNA damage after UV irradiation (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...