Vash2 (NM_144879) Mouse Recombinant Protein
CAT#: TP503958
Purified recombinant protein of Mouse vasohibin 2 (Vash2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203958 protein sequence
Red=Cloning site Green=Tags(s) MWLHVAKVHPRGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKTLQYNHTGTQFFEIRK MRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPISFKTYFSGNYFHHVVLGIYCNGYYG SLGMSRRAELMDKPLTFRTLSDLVFDFEDSYKKYLHTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKML RADIRKELEKYARDMRMKILKPASAHSPTQVRSRGKSLSPRRRQASPPRRLGRRDKSPALTEKKVADLGT LNEVGYQIRI myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 33.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659128 |
Locus ID | 226841 |
UniProt ID | Q8C5G2 |
Refseq Size | 4045 |
Cytogenetics | 1 H6 |
Refseq ORF | 873 |
Synonyms | B130052G07Rik |
Summary | Tyrosine carboxypeptidase that removes the C-terminal tyrosine residue of alpha-tubulin, thereby regulating microtubule dynamics and function (PubMed:29146868). Acts as an activator of angiogenesis: expressed in infiltrating mononuclear cells in the sprouting front to promote angiogenesis (PubMed:19204325).[UniProtKB/Swiss-Prot Function] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Vasohibin 2 promotes human luminal breast cancer angiogenesis in a non-paracrine manner via transcriptional activation of fibroblast growth factor 2.
,null,
Cancer letters
,PubMed ID 27702660
[Vash2]
|
Documents
FAQs |
SDS |