1110004E09Rik (NM_026502) Mouse Recombinant Protein

CAT#: TP503964

Purified recombinant protein of Mouse cilia and flagella associate protien 298 (Cfap298), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203964 protein sequence
Red=Cloning site Green=Tags(s)

MVVLHVKRGDESQFLLQAPGSTELEELTAQVARVYNGRLKVHRLCSEMEELAEHGVFLHPNMQGLTDEQI
EELKLKDEWGEKCVPSGGSVFTKDEIGRRNGQAPNEKMKQVLKKTVEEAKAIVSKKQVEAGVFVTMEMVK
DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAALEVIQESEAQLWWAAKELRRTKKLSDYVGK
NEKTKIIVKIQQRGQGAPAREPVISSEEHKQLMLFYHRRQEELKKLEENDDDSCLNSPWADNTALKRHFH
GVKDIKWRPR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 33.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080778
Locus ID 68001
UniProt ID Q8BL95
Refseq Size 1163
Cytogenetics 16 C3.3
Refseq ORF 873
Summary Plays a role in motile cilium function, possibly by acting on outer dynein arm assembly. Seems to be important for initiation rather than maintenance of cilium motility. Required for correct positioning of cilia at the apical cell surface, suggesting an additional role in the planar cell polarity (PCP) pathway. May suppress canonical Wnt signaling activity.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...