Aqp3 (NM_016689) Mouse Recombinant Protein

CAT#: TP503989

Purified recombinant protein of Mouse aquaporin 3 (Aqp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR203989 protein sequence
Red=Cloning site Green=Tags(s)

MGRQKELMNRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLG
ILVAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYALAQTLGAFLGAGIVFGLYYDAIWAFANNELFVSGP
NGTAGIFATYPSGHLDMVNGFFDQFIGTAALIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS
GYAVNPARDFGPRLFTALAGWGSEVFTTGRHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSTEEEN
VKLAHMKHKEQI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 31.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_057898
Locus ID 11828
UniProt ID Q8R2N1
Refseq Size 1763
Cytogenetics 4 A5
Refseq ORF 879
Synonyms AQP-2
Summary Water channel required to promote glycerol permeability and water transport across cell membranes. Acts as a glycerol transporter in skin and plays an important role in regulating SC (stratum corneum) and epidermal glycerol content. Involved in skin hydration, wound healing, and tumorigenesis. Provides kidney medullary collecting duct with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient. Slightly permeable to urea and may function as a water and urea exit mechanism in antidiuresis in collecting duct cells. It may play an important role in gastrointestinal tract water transport and in glycerol metabolism.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...