Slc25a5 (NM_007451) Mouse Recombinant Protein

CAT#: TP504134

Purified recombinant protein of Mouse solute carrier family 25 (mitochondrial carrier, adenine nucleotide translocator), member 5 (Slc25a5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204134 protein sequence
Red=Cloning site Green=Tags(s)

MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRIPKEQGVLSF
WRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTR
LAADVGKAGAEREFKGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHI
FISWMIAQSVTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGSKAFFKGAWSNVLR
GMGGAFVLVLYDEIKKYT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_031477
Locus ID 11740
UniProt ID P51881, Q545A2
Refseq Size 1238
Cytogenetics X 21.2 cM
Refseq ORF 897
Synonyms An; Ant2
Summary This gene encodes a transmembrane domain-containing protein that localizes to the mitochondrial inner membrane. The encoded protein facilitates the exchange of ADP from the cytoplasm with ATP from the mitochondria. Pseudogenes for this gene are found on multiple chromosomes. [provided by RefSeq, May 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...