Gnptg (NM_172529) Mouse Recombinant Protein

CAT#: TP504344

Purified recombinant protein of Mouse N-acetylglucosamine-1-phosphotransferase, gamma subunit (Gnptg), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
GNPTG Antibody - middle region
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204344 protein sequence
Red=Cloning site Green=Tags(s)

MAGRLAGFLMLLGLASQGPAPACAGKMKVVEEPNTFGLNNPFLPQASRLQPKREPSAVSGPLHLFRLAGK
CFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIINNTFKGMWMTDGDSCHSRSRQSKVEL
TCGKINRLAHVSEPSTCVYALTFETPLVCHPHSLLVYPTLSEALQQRWDQVEQDLADELITPQGYEKLLR
VLFEDAGYLKVPGETHPTQLAGGSKGLGLETLDNCRKAHAELSQEVQRLTSLLQQHGIPHTQPTETTHSQ
HLGQQLPIGAIAAEHLRSDPGLRGNIL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_766117
Locus ID 214505
UniProt ID Q6S5C2, A0A0R4J0H5
Refseq Size 1234
Cytogenetics 17 A3.3
Refseq ORF 924
Synonyms 6430527N14Rik; A830081F19; AU067667; AU067744; Mdcp1; Tce7
Summary Non-catalytic subunit of the N-acetylglucosamine-1-phosphotransferase complex, an enzyme that catalyzes the formation of mannose 6-phosphate (M6P) markers on high mannose type oligosaccharides in the Golgi apparatus. Binds and presents the high mannose glycans of the acceptor to the catalytic alpha and beta subunits (GNPTAB). Enhances the rate of N-acetylglucosamine-1-phosphate transfer to the oligosaccharides of acid hydrolase acceptors.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...