Cope (NM_021538) Mouse Recombinant Protein

CAT#: TP504352

Purified recombinant protein of Mouse coatomer protein complex, subunit epsilon (Cope), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204352 protein sequence
Red=Cloning site Green=Tags(s)

MAPPVPGAVSGGSGEVDELFDVKNAFYIGSYQQCINEAQRVKLSSPEREVERDVFLYRAYLAQRKYGVVL
DEIKPSSAPELQAVRMFAEYLASENQRDSIVLELDREMSRSVDVTNTTFLLMAASIYFHDQNPDAALRTL
HQGDGLECMAMTIQILLKLDRLDLARKELKKMQDQDEDATLTQLATAWVNLAVGGEKLQEAYYIFQELAD
KCSPTLLLLNGQAACHSAQGRWETAEGVLQEALDKDSGHPETLINLIVLSQHLGKPPEVTNRYLSQLKDA
HRAHPFIKEYQAKENDFDRLAMQYAPSA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 34.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067513
Locus ID 59042
UniProt ID O89079
Refseq Size 1043
Cytogenetics 8 B3.3
Refseq ORF 927
Synonyms 1110005D17Rik; Cope1
Summary The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. The coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated with ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...