Tomm34 (NM_025996) Mouse Recombinant Protein
CAT#: TP504376
Purified recombinant protein of Mouse translocase of outer mitochondrial membrane 34 (Tomm34), transcript variant Tom34b, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204376 protein sequence
Red=Cloning site Green=Tags(s) MAPKVSDSVEQLRAAGNQNFRNGQYGEASALYERALRLLQARGSADPEEESVLYSNRAACYLKDGNCTDC IKDCTSALALVPFSIKPLLRRASAYEALEKYALAYVDYKTVLQIDNSVASALEGINRITRALMDSLGPEW RLKLPPIPVVPVSAQKRWNSLPSDNHKETAKTKSKEATATKSRVPSAGDVERAKALKEEGNDLVKKGNHK KAIEKYSESLLCSSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSS LSDISSLLQIEPRNGPAQKLRQEVNQNMN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 34.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080272 |
Locus ID | 67145 |
UniProt ID | Q9CYG7 |
Refseq Size | 2319 |
Cytogenetics | 2 H3 |
Refseq ORF | 930 |
Synonyms | 2610100K07Rik; TOM34 |
Summary | Plays a role in the import of cytosolically synthesized preproteins into mitochondria. Binds the mature portion of precursor proteins. Interacts with cellular components, and possesses weak ATPase activity. May be a chaperone-like protein that helps to keep newly synthesized precursors in an unfolded import compatible state (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |