Rad18 (BC011120) Mouse Recombinant Protein

CAT#: TP504378

Purified recombinant protein of Mouse RAD18 homolog (S. cerevisiae) (cDNA clone MGC:19000 IMAGE:4014013), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204378 representing BC011120
Red=Cloning site Green=Tags(s)

MEVLAEPRWPPGLAVMKTIDDLLRCGICFEYFNIAVIIPQCSHNYCSLCIRKFLSYKTQCPTCCVAVTEP
DLRNNRLLDELVKSMNFARTHLLQFALESPPISPVSSTSKKVVVKVHNADAAQHPVKQGNRLMDKFLIRE
TGDCVFELLGKENERKFSPQKELSTSAEIKETSLLGKPVLGLSDANGPVTPSTSTMKLDTKVSCPVCGVS
IPENHINKHLDSCLSREEKKESLRSSAHKRKPLPKTVYNLLSDRDLKKKLKQYGLSVQGNKQQLIKRHQE
FVHMYNAQCDALHPKSGHGFYKEPNREGN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 54.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 58186
UniProt ID Q9QXK2
Refseq Size 1482
Cytogenetics 6 E3
Refseq ORF 927
Synonyms 2810024C04Rik; Rad18sc
Summary E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...