Plpp3 (NM_080555) Mouse Recombinant Protein

CAT#: TP504441

Purified recombinant protein of Mouse phospholipid phosphatase 3 (Plpp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204441 protein sequence
Red=Cloning site Green=Tags(s)

MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCND
ESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQNPYVAALYKQVGCFLFGCAI
SQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLY
LVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFK
TKTSLSLPAPAIRREILSPVDIIDRNNHHNMV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_542122
Locus ID 67916
UniProt ID Q99JY8
Refseq Size 3162
Cytogenetics 4 49.18 cM
Refseq ORF 939
Synonyms 1110003O22Rik; 2610002D05Rik; AV025606; D4Bwg0538e; D4Bwg1535e; Lpp3; Ppab2b; Ppap2b
Summary Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1-phosphate (S-1-P) (By similarity). Essential to the formation of the chorioallantoic placenta and extraembryonic vasculature. Also mediates gastrulation and axis formation, probably by regulating the Wnt signaling pathway.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...