Olig2 (NM_016967) Mouse Recombinant Protein

CAT#: TP504703

Purified recombinant protein of Mouse oligodendrocyte transcription factor 2 (Olig2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204703 representing NM_016967
Red=Cloning site Green=Tags(s)

MDSDASLVSSRPSSPEPDDLFLPARSKGGSSSGFTGGTVSSSTPSDCPPELSSELRGAMGASGAHPGDKL
GGGGFKSSSSSTSSSTSSAATSSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNIAMDGLREVMPYAHG
PSVRKLSKIATLLLARNYILMLTNSLEEMKRLVSEIYGGHHAGFHPSACGGLAHSAPLPTATAHPAAAAH
AAHHPAVHHPILPPAAAAAAAAAAAAAVSSASLPGSGLSSVGSIRPPHGLLKSPSAAAAAPLGGGGGGSG
GSGGFQHWGGMPCPCSMCQVPPPHHHVSAMGAGTLPRLTSDAK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 32.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_058663
Locus ID 50913
UniProt ID Q9EQW6, Q542S0
Refseq Size 2462
Cytogenetics 16 52.6 cM
Refseq ORF 969
Synonyms AI604895; Bhlhb1; bHLHe19; Olg-2; Oligo2; RK17
Summary Required for oligodendrocyte and motor neuron specification in the spinal cord, as well as for the development of somatic motor neurons in the hindbrain (PubMed:11955448, PubMed:12121626, PubMed:16908628). Functions together with ZNF488 to promote oligodendrocyte differentiation (PubMed:16908628). Cooperates with OLIG1 to establish the pMN domain of the embryonic neural tube (PubMed:11955448, PubMed:12121626). Antagonist of V2 interneuron and of NKX2-2-induced V3 interneuron development (PubMed:11955448, PubMed:12121626).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...