Osgep (NM_133676) Mouse Recombinant Protein
CAT#: TP504973
Purified recombinant protein of Mouse O-sialoglycoprotein endopeptidase (Osgep), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR204973 protein sequence
Red=Cloning site Green=Tags(s) MPAVLGFEGSANKIGVGVVRDGTVLANPRRTYVTAPGTGFLPGDTARHHRAVILDLLQEALAEAGLTSKD IDCIAFTKGPGMGAPLASVAVVARTVAQLWNKPLLGVNHCIGHIEMGRLITGAVNPTVLYVSGGNTQVIS YSEHRYRIFGETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGMDVSFSGILSF IEDAAQRMLATGECTPEDLCFSLQETVFAMLVEITERAMAHCGSKEALIVGGVGCNLRLQEMMGTMCQER GAQLFATDERFCVDNGAMIAQAGWEMFQAGHRTPLKDSAITQRYRTDEVEVTWRD myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 36.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_598437 |
Locus ID | 66246 |
UniProt ID | Q8BWU5, A0A0R4J1Y3, Q3UQ67 |
Refseq Size | 1608 |
Cytogenetics | 14 C1 |
Refseq ORF | 1008 |
Synonyms | 1500019L24Rik; GCPL-1; PRSMG1 |
Summary | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. OSGEP likely plays a direct catalytic role in this reaction, but requires other protein(s) of the complex to fulfill this activity.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |