Aurkb (NM_011496) Mouse Recombinant Protein
CAT#: TP505201
Purified recombinant protein of Mouse aurora kinase B (Aurkb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205201 protein sequence
Red=Cloning site Green=Tags(s) MAQKENAYPWPYGSKTSQSGLNTLSQRVLRKEPATTSALALVNRSNSQSTAAPGQKLAENKSQGSTASQG SQNKQPFTIDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEKEGVEHQLRREIEIQAHLKHP NILQLYNYFYDQQRIYLILEYAPRGELYKELQKSRTFDEQRTATIMEELSDALTYCHKKKVIHRDIKPEN LLLGLQGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEMVDLWCIGVLCYELMVGNPPFES PSHSETYRRIVKVDLKFPSSVPSGAQDLISKLLKHNPWQRLPLAEVAAHPWVRANSRRVLPPSAL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 39.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035626 |
Locus ID | 20877 |
UniProt ID | O70126 |
Refseq Size | 1957 |
Cytogenetics | 11 42.32 cM |
Refseq ORF | 1038 |
Synonyms | AI; Aik2; AIM-1; Aim1; AIRK2; AL022959; Ark2; AurB; I; IPL1; Stk; STK-; STK-1; Stk1; Stk5; Stk12 |
Summary | This gene encodes a member of the aurora kinase subfamily of serine/threonine kinases. The genes encoding the other two members of this subfamily are located on chromosomes 2 and 7. These kinases participate in the regulation of alignment and segregation of chromosomes during mitosis and meiosis through association with microtubules. [provided by RefSeq, Sep 2015] |
Documents
FAQs |
SDS |