Dkk3 (NM_015814) Mouse Recombinant Protein
CAT#: TP505281
Purified recombinant protein of Mouse dickkopf WNT signaling pathway inhibitor 3 (Dkk3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205281 protein sequence
Red=Cloning site Green=Tags(s) MQRLGGILLCTLLAAAVPTAPAPSPTVTWTPAEPGPALNYPQEEATLNEMFREVEELMEDTQHKLRSAVE EMEAEEAAAKTSSEVNLASLPPNYHNETSTETRVGNNTVHVHQEVHKITNNQSGQVVFSETVITSVGDEE GKRSHECIIDEDCGPTRYCQFSSFKYTCQPCRDQQMLCTRDSECCGDQLCAWGHCTQKATKGGNGTICDN QRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPTSQLLDLITWELEPEGALDRCPCASGLLCQPHSHSL VYMCKPAFVGSHDHSEESQLPREAPDEYEDVGFIGEVRQELEDLERSLAQEMAFEGPAPVESLGGEEEI myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 38.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_056629 |
Locus ID | 50781 |
UniProt ID | Q9QUN9 |
Refseq Size | 3357 |
Cytogenetics | 7 F1 |
Refseq ORF | 1050 |
Synonyms | AW061014; C87148; dkk-3; mDkk-3 |
Summary | Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |