Sae1 (NM_019748) Mouse Recombinant Protein

CAT#: TP505319

Purified recombinant protein of Mouse SUMO1 activating enzyme subunit 1 (Sae1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205319 protein sequence
Red=Cloning site Green=Tags(s)

MVEKEEAGGGGGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLIVGMKGLGAEIAKNLILAGVKGLTML
DHEQVSPEDPGAQFLIQTGSVGRNRAEASLERAQNLNPMVDVKVDTEDVEKKPESFFTKFDAVCLTCCSR
DVIIKVDQICHRNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPEAKRAKLDSSETTM
VKKKVLFCPVKEALEVDWSGEKAKAALKRTAPDYFLLQVLLKFRTDKGRDPTSESYKEDAELLLQIRNDV
FDSLGISPDLLPDDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGSGIVECLGPQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062722
Locus ID 56459
UniProt ID Q9R1T2
Refseq Size 2017
Cytogenetics 7 8.88 cM
Refseq ORF 1053
Synonyms 2400010M20Rik; 2610044L12Rik; AL033372; AOS1; AW743391; D7Ertd177e; HSPC140; Sua1; Uble1a
Summary The heterodimer acts as an E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...