Slc9a3r1 (NM_012030) Mouse Recombinant Protein
CAT#: TP505416
Purified recombinant protein of Mouse solute carrier family 9 (sodium/hydrogen exchanger), member 3 regulator 1 (Slc9a3r1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205416 protein sequence
Red=Cloning site Green=Tags(s) MSADAAAGEPLPRLCCLEKGPNGYGFHLHGEKGKVGQFIRLVEPGSPAEKSGLLAGDRLVEVNGENVEKE THQQVVSRIRAALNAVRLLVVDPETDERLKKLGVSIREELLRPQEKSEQAEPPAAADTHEAGDQNEAEKS HLRELRPRLCTMKKGPNGYGFNLHSDKSKPGQFIRAVDPDSPAEASGLRAQDRIVEVNGVCMEGKQHGDV VSAIKGGGDEAKLLVVDKETDEFFKKCKVIPSQEHLDGPLPEPFSNGEIQKESSREALVEPASESPRPAL ARSASSDTSEELNSQDSPKRQVSTEPSSTSSSSSDPILDLNISLAVAKERAHQKRSSKRAPQMDWSKKNE LFSNL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 38.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_036160 |
Locus ID | 26941 |
UniProt ID | P70441, Q3TG37 |
Refseq Size | 1922 |
Cytogenetics | 11 E2 |
Refseq ORF | 1068 |
Synonyms | EBP-50; NHE-RF; NHERF-1; NHERF1 |
Summary | Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression. Necessary for recycling of internalized ADRB2. Was first known to play a role in the regulation of the activity and subcellular location of SLC9A3. Necessary for cAMP-mediated phosphorylation and inhibition of SLC9A3. May enhance Wnt signaling (By similarity). May participate in HTR4 targeting to microvilli. Involved in the regulation of phosphate reabsorption in the renal proximal tubules (By similarity). Involved in sperm capacitation. May participate in the regulation of the chloride and bicarbonate homeostasis in spermatozoa.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Slc9a3r1产品