Foxi1 (NM_023907) Mouse Recombinant Protein

CAT#: TP505758

Purified recombinant protein of Mouse forkhead box I1 (Foxi1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
FOXI1 Antibody - N-terminal region
    • 50 ug

CNY 4,381.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205758 protein sequence
Red=Cloning site Green=Tags(s)

MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGMPSPQRPTSFEGGGEYGTTPNPYLWLNGPA
MTPPPYLPGTNASPFLPQAYGMQRQLLPSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDQRLTL
SQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKR
KRKSDSSSSTSSLASEKTENGLLASSPKPTEPQEVLDTASPDTTTSSPEKRSSPAPSGTPCLNNFLSTMT
AYVSGTNPISRSVATPGLSSEPIDKMGQNSLNFNSYTPLTNLSSHGNGGEWANPVATNALGYGGSVFNQF
SPHFYNSINTNGILFPREGTEV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_076396
Locus ID 14233
UniProt ID Q922I5
Refseq Size 2354
Cytogenetics 11 19.65 cM
Refseq ORF 1119
Synonyms 5830401E05Rik; Fkh10; FREAC6; HFH-3; Hfh3
Summary Transcriptional activator required for the development of normal hearing, sense of balance and kidney function. Required for the expression of SLC26A4/PDS, JAG1 and COCH in a subset of epithelial cells and the development of the endolymphatic system in the inner ear. Also required for the expression of SLC4A1/AE1, SLC4A9/AE4, ATP6V1B1 and the differentiation of intercalated cells in the epithelium of distal renal tubules.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...