Rnf34 (NM_030564) Mouse Recombinant Protein
CAT#: TP505854
Purified recombinant protein of Mouse ring finger protein 34 (Rnf34), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205854 protein sequence
Red=Cloning site Green=Tags(s) MKAGATSMWASCCGLLNEVMGTGAVRGQQAGFPGSTGPFRFTPSSDFPTYPPAATEGPNIVCKACGLSFS VFRKKHVCCDCKKDFCSLCSVSQENLRRCSTCHLLQETAFQRPQLMRLKVKDLRQYLLLRNIPTDTCREK EDLVDLVLCHRGLGSGDDLDSSSLNSSRSQTSSFFTQSLFSNYTPPSATVSSFQGELMDRDGAFRSEVLA QVQSEIASANTDDDDDDDDDDDDDEDDDDEQEEEEQNPGLSKKKARASLSDLSSLEEVEGMSVRQLKEIL ARNFVNYSGCCEKWELVEKVNRLYKENEENQKSYGERMQLQDEEDDSLCRICMDAVIDCVLLECGHMVTC TKCGKRMSECPICRQYVVRAVHVFKS myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 42 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_085041 |
Locus ID | 80751 |
UniProt ID | Q99KR6 |
Refseq Size | 1980 |
Cytogenetics | 5 F |
Refseq ORF | 1131 |
Synonyms | AW061037; AW536122; BC004042; C88279; RIFF |
Summary | E3 ubiquitin-protein ligase that regulates several biological processes through the ubiquitin-mediated proteasomal degradation of various target proteins. Ubiquitinates the caspases CASP8 and CASP10, promoting their proteasomal degradation, to negatively regulate cell death downstream of death domain receptors in the extrinsic pathway of apoptosis. May mediate 'Lys-48'-linked polyubiquitination of RIPK1 and its subsequent proteasomal degradation thereby indirectly regulating the tumor necrosis factor-mediated signaling pathway. Negatively regulates p53/TP53 through its direct ubiquitination and targeting to proteasomal degradation. Indirectly, may also negatively regulate p53/TP53 through ubiquitination and degradation of SFN. Mediates PPARGC1A proteasomal degradation probably through ubiquitination thereby indirectly regulating the metabolism of brown fat cells (PubMed:22064484). Possibly involved in innate immunity, through 'Lys-48'-linked polyubiquitination of NOD1 and its subsequent proteasomal degradation.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |