Sox18 (NM_009236) Mouse Recombinant Protein
CAT#: TP505890
Purified recombinant protein of Mouse SRY (sex determining region Y)-box 18 (Sox18), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205890 representing NM_009236
Red=Cloning site Green=Tags(s) MQRSPPGYGAQDDPPSRRDCAWAPGIGAAAEARGLPVTNVSPTSPASPSSLPRSPPRSPESGRYGFGRGE RQTADELRIRRPMNAFMVWAKDERKRLAQQNPDLHNAVLSKMLGKAWKELNTAEKRPFVEEAERLRVQHL RDHPNYKYRPRRKKQARKVRRLEPGLLLPGLVQPSAPPEAFAAASGSARSFRELPTLGAEFDGLGLPTPE RSPLDGLEPGEASFFPPPLAPEDCALRAFRAPYAPELARDPSFCYGAPLAEALRTAPPAAPLAGLYYGTL GTPGPFPNPLSPPPESPSLEGTEQLEPTADLWADVDLTEFDQYLNCSRTRPDATTLPYHVALAKLGPRAM SCPEESSLISALSDASSAVYYSACISG myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 41.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_033262 |
Locus ID | 20672 |
UniProt ID | P43680 |
Refseq Size | 1619 |
Cytogenetics | 2 103.71 cM |
Refseq ORF | 1131 |
Synonyms | AI385749; Ra; Ragl |
Summary | Transcriptional activator that binds to the consensus sequence 5'-AACAAAG-3' in the promoter of target genes and plays an essential role in embryonic cardiovascular development and lymphangiogenesis (PubMed:7651823, PubMed:10742113, PubMed:12748961, PubMed:18931657, PubMed:19429912, PubMed:26939885). Activates transcription of PROX1 and other genes coding for lymphatic endothelial markers (PubMed:18931657, PubMed:26939885). Plays an essential role in triggering the differentiation of lymph vessels, but is not required for the maintenance of differentiated lymphatic endothelial cells (PubMed:18931657). Plays an important role in postnatal angiogenesis, where it is functionally redundant with SOX17 (PubMed:16895970). Interaction with MEF2C enhances transcriptional activation (PubMed:11554755). Besides, required for normal hair development (PubMed:11094083, PubMed:12748961).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |