Slc30a7 (NM_023214) Mouse Recombinant Protein

CAT#: TP505895

Purified recombinant protein of Mouse solute carrier family 30 (zinc transporter), member 7 (Slc30a7), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205895 protein sequence
Red=Cloning site Green=Tags(s)

MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH
MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER
LLLVSILGFVVNLVGIFVFNHGGHGHSHGSGHGHSHSLFNGALDHSHGHEDHCHSHEAKHGAAHSHDHDH
AHGHGHLHSHDGPSFKATAGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILI
VVSVIPLLRESVGILMQRTPPSLENTLPQCYQRVQQLQGVYNLQEQHFWTLCSDVYVGTLKLVVAPDADA
RWILSQTHNIFTQAGVRQLYVQIDFAAM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_075703
Locus ID 66500
UniProt ID Q9JKN1
Refseq Size 9020
Cytogenetics 3 G1
Refseq ORF 1137
Synonyms 1810059J10Rik; 2610034N15Rik; 4833428C12Rik; AI467242; ZnT-7; ZnT7; Zntl2
Summary Seems to facilitate zinc transport from the cytoplasm into the Golgi apparatus. Partly regulates cellular zinc homeostasis. Required with ZNT5 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and the vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs. Required with ZNT5 and ZNT6 for the activation of TNAP (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...