Eipr1 (NM_201357) Mouse Recombinant Protein

CAT#: TP506040

Purified recombinant protein of Mouse EARP complex and GARP complex interacting protein 1 (Eipr1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206040 protein sequence
Red=Cloning site Green=Tags(s)

MEDDAPVIYGLEFQARALTPQTAETDAIRFLVGTQSLKYDNQIHIIDFDDENNIINKNVLLHQAGEIWHI
SASPADKGVLATCYNKTTDSRVQACAAVWRMPKELESGSHESPDDPASTAQTLELLCHLDNSAQGNVACV
VWEPMGDGKKVISLADSHILLWDLQPSSSQAVLASSATLEGRGQLKFTAGRWSPHHNCTQVATASDTTLR
GWDTRSMSQIYCIENAHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTEPVKTLEEHSHWVWSVRY
NHSHDQLVLTGSSDSRVILSNMVSISSEPFGHLVDDDDVSDPEEHHAEKSKEPLQDNVIATYEEHEDSVY
AVDWASADPWLFASLSYDGRLVINRVPRALKYHILL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 43.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_958745
Locus ID 380752
UniProt ID Q8K0G5
Refseq Size 1692
Cytogenetics 12 11.26 cM
Refseq ORF 1161
Synonyms D12Ertd604e; Eipr1; Tssc1
Summary Acts as a component of endosomal retrieval machinery that is involved in protein transport from early endosomes to either recycling endosomes or the trans-Golgi network. Mediates the recruitment of Golgi-associated retrograde protein (GARP) complex to the trans-Golgi network and controls early endosome-to-Golgi transport of internalized protein. Promotes the recycling of internalized transferrin receptor (TFRC) to the plasma membrane through interaction with endosome-associated recycling protein (EARP) complex.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...