Rmnd5b (NM_025346) Mouse Recombinant Protein
CAT#: TP506134
Purified recombinant protein of Mouse required for meiotic nuclear division 5 homolog B (Rmnd5b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206134 protein sequence
Red=Cloning site Green=Tags(s) MEQCACVERELDKVLHKFLTYGQHCEQSLEELLHSVGQLRAELASAALQGTPLSATLSLVMSQCCRKIRD TVQKLASDHKDIHSSVSRVGKAIDRNFDSEICGVVSDAVWDSREKQQQILQMAIVEHLYQQGMLSVAEEL CQESTLNVDLDFKQPFLELNRILEALHEQDLGPALEWAVSHRQRLLELNSSLEFKLHRLHFIRLLAGGPE KQLEALSYARHFQPFARLHQREIQVMMGSLVYLRLGLEKSPYCHLLDNSHWAEICETFTRDACSLLGLSV ESPLSVSFASGCVALPVLMNIKAVIEQRQCTGVWSHKDELPIEIELGMKCWYHSVFACPILRQQTSDSNP PIKLICGHVISRDALNKLINGGKLKCPYCPMEQNPADGKRIIF myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 44.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079622 |
Locus ID | 66089 |
UniProt ID | Q91YQ7 |
Refseq Size | 1946 |
Cytogenetics | 11 B1.3 |
Refseq ORF | 1182 |
Synonyms | 0610039K22Rik; Gid2 |
Summary | Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. MAEA and RMND5A are both required for catalytic activity of the CTLH E3 ubiquitin-protein ligase complex. Catalytic activity of the complex is required for normal cell proliferation. The CTLH E3 ubiquitin-protein ligase complex is not required for the degradation of enzymes involved in gluconeogenesis, such as FBP1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |