Rmnd5b (NM_025346) Mouse Recombinant Protein

CAT#: TP506134

Purified recombinant protein of Mouse required for meiotic nuclear division 5 homolog B (Rmnd5b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206134 protein sequence
Red=Cloning site Green=Tags(s)

MEQCACVERELDKVLHKFLTYGQHCEQSLEELLHSVGQLRAELASAALQGTPLSATLSLVMSQCCRKIRD
TVQKLASDHKDIHSSVSRVGKAIDRNFDSEICGVVSDAVWDSREKQQQILQMAIVEHLYQQGMLSVAEEL
CQESTLNVDLDFKQPFLELNRILEALHEQDLGPALEWAVSHRQRLLELNSSLEFKLHRLHFIRLLAGGPE
KQLEALSYARHFQPFARLHQREIQVMMGSLVYLRLGLEKSPYCHLLDNSHWAEICETFTRDACSLLGLSV
ESPLSVSFASGCVALPVLMNIKAVIEQRQCTGVWSHKDELPIEIELGMKCWYHSVFACPILRQQTSDSNP
PIKLICGHVISRDALNKLINGGKLKCPYCPMEQNPADGKRIIF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 44.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_079622
Locus ID 66089
UniProt ID Q91YQ7
Refseq Size 1946
Cytogenetics 11 B1.3
Refseq ORF 1182
Synonyms 0610039K22Rik; Gid2
Summary Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. MAEA and RMND5A are both required for catalytic activity of the CTLH E3 ubiquitin-protein ligase complex. Catalytic activity of the complex is required for normal cell proliferation. The CTLH E3 ubiquitin-protein ligase complex is not required for the degradation of enzymes involved in gluconeogenesis, such as FBP1.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...