Polr3d (NM_025945) Mouse Recombinant Protein

CAT#: TP506248

Purified recombinant protein of Mouse polymerase (RNA) III (DNA directed) polypeptide D (Polr3d), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206248 representing NM_025945
Red=Cloning site Green=Tags(s)

MSEGNAAGEPSNPGGPRPLLSGGRGLIGRRPAPPLTPGRLPSIRSRDLTLGGVKKKTFTPNIISRKIKEE
PKEEVTMKKEKRERDRDRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDMSDMGPSHIINI
KKEKRETDEETKQILRMLEKDDFIDDPGLKNDTRNMPVQLPLAHSGWLFKEESEEPEAKPLSAGPKEEDM
EVDVPAVKVKEEPRDEEEEAKVKAPPRAARKTPGLPKDVSVAELLRELSLMKDEELLFLQLPDTLPGQPP
TQDIKPVKTEVQGEDGQMVVIKQEKDREARLAENACTLADLTEGQVGKLLIRKSGKVQLLLGKVTLDVTM
GTTCSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDHKHR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 44.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080221
Locus ID 67065
UniProt ID Q91WD1
Refseq Size 1998
Cytogenetics 14 D2
Refseq ORF 1194
Synonyms 44kDa; 2810426M17Rik; AI326118; AW489084; BN51T; RPC4; TSBN51
Summary DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Specific component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...