Wdr4 (BC039272) Mouse Recombinant Protein

CAT#: TP506503

Purified recombinant protein of Mouse WD repeat domain 4 (cDNA clone MGC:35877 IMAGE:5027600), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206503 protein sequence
Red=Cloning site Green=Tags(s)

MASSAGLALCAQTLVVRGGSRFLAFSTTGSDDDCVFTYDCSTAEKKATPEDKGEDGQPADTGSDSILAST
FSKSGRYFALTDDSKRLILFRTKPWQCLSVRMVVRRCTALTFTASEDRVLVADKSGDVYSFSVLEPDGCG
RLELGHLSMLLDVAVSPDDQFVLTADRDEKIRVSWAAAPHSIESFCLGHTEFVSRILVVPSHPELLLSSS
GDGTLRLWEYRSGRQLQCCDLAGLQEPGEQPGHKGLAASRIAFWGQESYVVLLCECVPVVFVFQLDASRQ
QLVFRQRLTFPHRVWDVVFEEARGLWVLQDCRDAPLVLWRPVGGEWQAAPDGAVSPRLCSHLRESWAMLE
GSVGTDDSFRSLYKATFDNMTSYLKKKEERLQQQLKKKRQRSPFPGSPEQTKKACPGQSALSC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 57773
UniProt ID Q9EP82
Refseq Size 2054
Cytogenetics 17 B1
Refseq ORF 1239
Synonyms AI415180; AI448349; D530049K22Rik
Summary Non-catalytic component of a methyltransferase complex required for the formation of N(7)-methylguanine in a subset of RNA species, such as tRNAs, mRNAs and microRNAs (miRNAs) (PubMed:29983320). In the methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit (By similarity). Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA (PubMed:29983320). Also required for the formation of N(7)-methylguanine at internal sites in a subset of mRNAs (By similarity). Also required for methylation of a specific subset of miRNAs, such as let-7 (By similarity). Acts as a regulator of embryonic stem cell self-renewal and differentiation (PubMed:29983320). Independently of METTL1, also plays a role in genome stability: localizes at the DNA replication site and regulates endonucleolytic activities of FEN1 (PubMed:29574139).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...